Click image to see more details
Product Info Summary
| SKU: | PROTO43399 |
|---|---|
| Size: | 20 µg |
| Source: | HEK293T |
Customers Who Bought This Also Bought
Product info
Product Name
TPD52L2 (NM_199359) Human Recombinant Protein
View all TPD52L2/D54 recombinant proteins
SKU/Catalog Number
PROTO43399
Size
20 µg
Tag
C-Myc/DDK
Description
Recombinant protein of human tumor protein D52-like 2 (TPD52L2), transcript variant 6
Storage & Handling
Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)
Cite This Product
TPD52L2 (NM_199359) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43399)
Form
Frozen Solution in PBS Buffer
Formulation
25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Concentration
>50 ug/mL as determined by microplate BCA method
Purity
> 80% as determined by SDS-PAGE and Coomassie blue staining
Predicted MW
19.7 kDa
Amino Acid Sequence
MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPFXAssay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
Coomassie blue staining of purified TPD52L2 protein. The protein was produced from HEK293T cells transfected with TPD52L2 cDNA clone.
Protein Target Info & Infographic
Gene/Protein Information For TPD52L2 (Source: Uniprot.org, NCBI)
Gene Name
TPD52L2
Full Name
Tumor protein D54
Weight
19.7 kDa
Superfamily
TPD52 family
Alternative Names
DKFZp686A1765; HCCR-binding protein 2; tumor protein D52-like 2hD54D54; tumor protein D54 TPD52L2 D54, TPD54 TPD52 like 2 tumor protein D54|HCCR-binding protein 2|tumor protein D52 like 2
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on TPD52L2, check out the TPD52L2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for TPD52L2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For TPD52L2 (NM_199359) Human Recombinant Protein (PROTO43399)
Hello CJ!
No publications found for PROTO43399
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used TPD52L2 (NM_199359) Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For TPD52L2 (NM_199359) Human Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
