DEF6 (NM_022047) Human Recombinant Protein

Def6 protein,

Recombinant protein of human differentially expressed in FDCP 6 homolog (mouse) (DEF6)

Product Info Summary

SKU: PROTQ9H4E7
Size: 20 µg
Source: HEK293T

Product Name

DEF6 (NM_022047) Human Recombinant Protein

View all Def6 recombinant proteins

SKU/Catalog Number

PROTQ9H4E7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human differentially expressed in FDCP 6 homolog (mouse) (DEF6)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DEF6 (NM_022047) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9H4E7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

73.7 kDa

Amino Acid Sequence

MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTATRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQRERRRAAKEEELLRLQQLQEEKERKLQELELLQEAQRQAERLLQEEEERRRSQHRELQQALEGQLREAEQARASMQAEMELKEEEAARQRQRIKELEEMQQRLQEALQLEVKARRDEESVRIAQTRLLEEEEEKLKQLMQLKEEQERYIERAQQEKEELQQEMAQQSRSLQQAQQQLEEVRQNRQRADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKRPVTSSSFSGFQPPLLAHRDSSLKRLTRWGSQGNRTPSPNSNEQQKSLNGGDEAPAPASTPQEDKLDPAPEN

Validation Images & Assay Conditions

Gene/Protein Information For Def6 (Source: Uniprot.org, NCBI)

Gene Name

Def6

Full Name

Differentially expressed in FDCP 6

Weight

73.7 kDa

Alternative Names

DEF-6; differentially expressed in FDCP 6 homolog (mouse); differentially expressed in FDCP 6 homolog; IBPdifferentially expressed in FDCP (mouse homolog) 6; IRF4-binding protein; SLAT; SWAP70L; SWAP-70-like adaptor protein of T cells Def6|2410003F05Rik, 6430538D02Rik, AV094905, I, Ibp, S, Slat, Slat2, Slat6|differentially expressed in FDCP 6|differentially expressed in FDCP 6|DEF-6|IRF-4-binding protein|IRF4-binding protein|SWAP-70-like adapter of T-cells

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Def6, check out the Def6 Infographic

Def6 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Def6: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9H4E7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DEF6 (NM_022047) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DEF6 (NM_022047) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DEF6 (NM_022047) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9H4E7
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.