TMIGD2 (NM_144615) Human Recombinant Protein

TMIGD2 protein,

Recombinant protein of human transmembrane and immunoglobulin domain containing 2 (TMIGD2)

Product Info Summary

SKU: PROTQ96BF3
Size: 20 µg
Source: HEK293T

Product Name

TMIGD2 (NM_144615) Human Recombinant Protein

View all TMIGD2 recombinant proteins

SKU/Catalog Number

PROTQ96BF3

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human transmembrane and immunoglobulin domain containing 2 (TMIGD2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

TMIGD2 (NM_144615) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96BF3)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

30.5 kDa

Amino Acid Sequence

MGSPGMVLGLLVQIWALQEASSLSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPGFLFVLLGVGSMGVAAIVWGAWFWGRRSCQQRDSGNSPGNAFYSNVLYRPRGPPKKSEDCSGEGKDQRGQSIYSTSFPQPAPRQPHLASRPCPSPRPCPSPRPGHPVSMVRVSPRPSPTQQPRPKGFPKVGEE

Validation Images & Assay Conditions

Gene/Protein Information For TMIGD2 (Source: Uniprot.org, NCBI)

Gene Name

TMIGD2

Full Name

Transmembrane and immunoglobulin domain-containing protein 2

Weight

30.5 kDa

Alternative Names

CD28H; IGPR1; IGPR-1; MGC23244; TMIGD2; transmembrane and immunoglobulin domain containing 2; transmembrane and immunoglobulin domain-containing protein 2 TMIGD2 CD28H, IGPR-1, IGPR1 transmembrane and immunoglobulin domain containing 2 transmembrane and immunoglobulin domain-containing protein 2|CD28 homolog|CD28 homologue|immunoglobulin and proline-rich receptor 1|immunoglobulin-containing and proline-rich receptor 1|transmembrane and immunoglobulin domain-containing protein 2 variant 2|transmembrane and immunoglobulin domain-containing protein 2 variant 3

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TMIGD2, check out the TMIGD2 Infographic

TMIGD2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TMIGD2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96BF3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used TMIGD2 (NM_144615) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For TMIGD2 (NM_144615) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for TMIGD2 (NM_144615) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96BF3
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.