SKA1 (NM_145060) Human Recombinant Protein

Ska1 protein,

Product Info Summary

SKU: PROTQ96BD8
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SKA1 (NM_145060) Human Recombinant Protein

View all Ska1 recombinant proteins

SKU/Catalog Number

PROTQ96BD8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 18 open reading frame 24 (C18orf24), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SKA1 (NM_145060) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96BD8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

29.3 kDa

Amino Acid Sequence

MASSDLEQLCSHVNEKIGNIKKTLSLRNCGQEPTLKTVLNKIGDEIIVINELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENVPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEMPFITCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYFIVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVIT

Validation Images & Assay Conditions

Gene/Protein Information For SKA1 (Source: Uniprot.org, NCBI)

Gene Name

SKA1

Full Name

Spindle and kinetochore-associated protein 1

Weight

29.3 kDa

Superfamily

SKA1 family

Alternative Names

C18orf24; chromosome 18 open reading frame 24; MGC10200; spindle and kinetochore associated complex subunit 1; spindle and kinetochore-associated protein 1; spindle and KT (kinetochore) associated 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SKA1, check out the SKA1 Infographic

SKA1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SKA1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96BD8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SKA1 (NM_145060) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SKA1 (NM_145060) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SKA1 (NM_145060) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96BD8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.