SH2D1A (NM_002351) Human Recombinant Protein

SH2D1A protein,

Product Info Summary

SKU: PROTO60880
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SH2D1A (NM_002351) Human Recombinant Protein

View all SH2D1A recombinant proteins

SKU/Catalog Number

PROTO60880

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human SH2 domain protein 1A (SH2D1A), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SH2D1A (NM_002351) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO60880)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

14 kDa

Amino Acid Sequence

MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP

Validation Images & Assay Conditions

Gene/Protein Information For SH2D1A (Source: Uniprot.org, NCBI)

Gene Name

SH2D1A

Full Name

SH2 domain-containing protein 1A

Weight

14 kDa

Alternative Names

DSHP; DSHPLYP; Duncan disease SH2-protein; EBVS; FLJ92177; IMD5; LYP; MTCP1; SAP/SH2D1A; SAPlymphoproliferative syndrome; SH2 domain containing 1A; SH2 domain-containing protein 1A; SH2D1A; signaling lymphocyte activation molecule-associated protein; Signaling lymphocytic activation molecule-associated protein; SLAM associated protein/SH2 domain protein 1A; SLAM-associated protein; T cell signal transduction molecule SAP; T-cell signal transduction molecule SAP; XLP; XLPD; XLPDFLJ18687; XLPSH2 domain protein 1A SH2D1A DSHP, EBVS, IMD5, LYP, MTCP1, SAP, SAP/SH2D1A, XLP, XLPD, XLPD1 SH2 domain containing 1A SH2 domain-containing protein 1A|Duncan disease SH2-protein|SLAM associated protein/SH2 domain protein 1A|SLAM-associated protein|T cell signal transduction molecule SAP|signaling lymphocyte activation molecule-associated protein|signaling lymphocytic activation molecule-associated protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SH2D1A, check out the SH2D1A Infographic

SH2D1A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SH2D1A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO60880

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SH2D1A (NM_002351) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SH2D1A (NM_002351) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SH2D1A (NM_002351) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO60880
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.