SFTPA1 (NM_001164646) Human Recombinant Protein

Surfactant Protein A protein,

Purified recombinant protein of Homo sapiens surfactant protein A1 (SFTPA1), transcript variant 6.

Product Info Summary

SKU: PROTQ8IWL2
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SFTPA1 (NM_001164646) Human Recombinant Protein

View all Surfactant Protein A recombinant proteins

SKU/Catalog Number

PROTQ8IWL2

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens surfactant protein A1 (SFTPA1), transcript variant 6.

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

SFTPA1 (NM_001164646) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8IWL2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.5 kDa

Amino Acid Sequence

MWLCPLALNLILMAASGAVCEVKDVCVGTPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF

Validation Images & Assay Conditions

Gene/Protein Information For SFTPA1 (Source: Uniprot.org, NCBI)

Gene Name

SFTPA1

Full Name

Pulmonary surfactant-associated protein A

Weight

21.5 kDa

Superfamily

SFTPA family

Alternative Names

COLEC4; PSAP; PSPA; PSP-A; SFTP1; SFTPA1; SFTPA1B; SPA; SP-A; SPA1; SP-A1; surfactant protein A1B Sftpa1|S, SFT, SP-A, Sftp, Sftp-1, Sftp1|surfactant associated protein A1|pulmonary surfactant-associated protein A|PSAP|PSP-A|surfactant pulmonary associated protein A1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SFTPA1, check out the SFTPA1 Infographic

SFTPA1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SFTPA1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8IWL2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SFTPA1 (NM_001164646) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SFTPA1 (NM_001164646) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SFTPA1 (NM_001164646) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8IWL2
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.