ROC1 (RBX1) (NM_014248) Human Recombinant Protein

RBX1 protein,

Recombinant protein of human ring-box 1 (RBX1)

Product Info Summary

SKU: PROTP62877
Size: 20 µg
Source: HEK293T

Product Name

ROC1 (RBX1) (NM_014248) Human Recombinant Protein

View all RBX1 recombinant proteins

SKU/Catalog Number

PROTP62877

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ring-box 1 (RBX1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

ROC1 (RBX1) (NM_014248) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP62877)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.1 kDa

Amino Acid Sequence

MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

Validation Images & Assay Conditions

Gene/Protein Information For RBX1 (Source: Uniprot.org, NCBI)

Gene Name

RBX1

Full Name

E3 ubiquitin-protein ligase RBX1

Weight

12.1 kDa

Superfamily

RING-box family

Alternative Names

BA554C12.1; EC 6.3.2.-; FLJ60363; MGC13357; Protein ZYP; RBX1; Regulator of cullins 1; Ring Box 1; RING box protein 1; RING finger protein 75; ring-box 1; ring-box 1, E3 ubiquitin protein ligase; RING-box protein 1; RNF75; RNF75MGC1481; ROC1E3 ubiquitin-protein ligase RBX1; ZYP Protein RBX1 BA554C12.1, RNF75, ROC1 ring-box 1 E3 ubiquitin-protein ligase RBX1|E3 ubiquitin-protein transferase RBX1|RING finger protein 75|RING-box protein 1|ZYP protein|regulator of cullins 1|ring-box 1, E3 ubiquitin protein ligase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RBX1, check out the RBX1 Infographic

RBX1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RBX1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP62877

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ROC1 (RBX1) (NM_014248) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For ROC1 (RBX1) (NM_014248) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ROC1 (RBX1) (NM_014248) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP62877
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.