p27 KIP 1 (CDKN1B) (NM_004064) Human Recombinant Protein

p27/Kip1 protein,

Product Info Summary

SKU: PROTP46527
Size: 20 µg
Source: HEK293T

Product Name

p27 KIP 1 (CDKN1B) (NM_004064) Human Recombinant Protein

View all p27/Kip1 recombinant proteins

SKU/Catalog Number

PROTP46527

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human cyclin-dependent kinase inhibitor 1B (p27, Kip1) (CDKN1B)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

p27 KIP 1 (CDKN1B) (NM_004064) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP46527)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.9 kDa

Amino Acid Sequence

MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT

Validation Images & Assay Conditions

Gene/Protein Information For CDKN1B (Source: Uniprot.org, NCBI)

Gene Name

CDKN1B

Full Name

Cyclin-dependent kinase inhibitor 1B

Weight

21.9 kDa

Superfamily

CDI family

Alternative Names

CDKN1B; CDKN4; cyclin-dependent kinase inhibitor 1B (p27, Kip1); cyclin-dependent kinase inhibitor 1B; Cyclin-dependent kinase inhibitor p27; Kip1; KIP1P27KIP1; MEN1B; MEN4; p27; p27Kip1 CDKN1B CDKN4, KIP1, MEN1B, MEN4, P27KIP1 cyclin dependent kinase inhibitor 1B cyclin-dependent kinase inhibitor 1B|cyclin-dependent kinase inhibitor 1B (p27, Kip1)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CDKN1B, check out the CDKN1B Infographic

CDKN1B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CDKN1B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP46527

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used p27 KIP 1 (CDKN1B) (NM_004064) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For p27 KIP 1 (CDKN1B) (NM_004064) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for p27 KIP 1 (CDKN1B) (NM_004064) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP46527
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.