RND1 (NM_014470) Human Recombinant Protein

RND1 protein,

Product Info Summary

SKU: PROTQ92730
Size: 20 µg
Source: HEK293T

Product Name

RND1 (NM_014470) Human Recombinant Protein

View all RND1 recombinant proteins

SKU/Catalog Number

PROTQ92730

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human Rho family GTPase 1 (RND1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RND1 (NM_014470) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ92730)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

25.9 kDa

Amino Acid Sequence

MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM

Validation Images & Assay Conditions

Gene/Protein Information For RND1 (Source: Uniprot.org, NCBI)

Gene Name

RND1

Full Name

Rho-related GTP-binding protein Rho6

Weight

25.9 kDa

Superfamily

small GTPase superfamily

Alternative Names

ARHS; GTP-binding protein; ras homolog gene family, member S; Rho family GTPase 1FLJ42294; RHO6; rho-related GTP-binding protein Rho6; RHOS; Rnd1 RND1 ARHS, RHO6, RHOS Rho family GTPase 1 rho-related GTP-binding protein Rho6|ras homolog gene family, member S

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RND1, check out the RND1 Infographic

RND1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RND1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ92730

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RND1 (NM_014470) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RND1 (NM_014470) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RND1 (NM_014470) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ92730
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.