RGS19 (NM_001039467) Human Recombinant Protein

RGS19 protein,

Product Info Summary

SKU: PROTP49795
Size: 20 µg
Source: HEK293T

Product Name

RGS19 (NM_001039467) Human Recombinant Protein

View all RGS19 recombinant proteins

SKU/Catalog Number

PROTP49795

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human regulator of G-protein signaling 19 (RGS19), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RGS19 (NM_001039467) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP49795)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.5 kDa

Amino Acid Sequence

MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSEA

Validation Images & Assay Conditions

Gene/Protein Information For RGS19 (Source: Uniprot.org, NCBI)

Gene Name

RGS19

Full Name

Regulator of G-protein signaling 19

Weight

24.5 kDa

Alternative Names

G alpha interacting protein; GAIPG protein signalling regulator 19; G-alpha-interacting protein; GNAI3IP; guanine nucleotide binding protein alpha inhibiting activity polypeptide 3interacting protein; regulator of G-protein signaling 19; regulator of G-protein signalling 19; RGSGAIP RGS19 GAIP, RGSGAIP regulator of G protein signaling 19 regulator of G-protein signaling 19|G alpha interacting protein|G protein signalling regulator 19|guanine nucleotide binding protein alpha inhibiting activity polypeptide 3 interacting protein|regulator of G-protein signalling 19

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RGS19, check out the RGS19 Infographic

RGS19 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RGS19: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP49795

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RGS19 (NM_001039467) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RGS19 (NM_001039467) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RGS19 (NM_001039467) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP49795
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.