Click image to see more details
Product Info Summary
| SKU: | PB9693 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband®
View all Casein Kinase 1 alpha Antibodies
SKU/Catalog Number
PB9693
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband® catalog # PB9693. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9693)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
PB9693 is reactive to CSNK1A1 in Human, Mouse, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
39 kDa
Calculated molecular weight
38915 MW
Background of Casein Kinase 1 alpha
Casein kinase I isoform alpha is an enzyme that in humans is encoded by the CSNK1A1 gene. The CSNK1A1 gene is mapped to chromosome 5q32 based on an alignment of the CSNK1A1 sequence with the genomic sequence (GRCh37). It is reported that both screens identified CK1-alpha as a bifunctional regulator of NF-kappa-B. CK1-alpha dynamically associates with the CBM complex on T cell receptor engagement to participate in cytokine production and lymphocyte proliferation. However, CK1-alpha kinase activity has a contrasting role by subsequently promoting the phosphorylation and inactivation of CARMA1. CK1-alpha has thus a dual 'gating' function which first promotes and then terminates receptor-induced NF-kappa-B. ABC DLBCL cells required CK1-alpha for constitutive NF-kappa-B activity, indicating that CK1-alpha functions as a conditionally essential malignancy gene.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9693 is guaranteed for IHC, WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Positive Control
WB: Rat Brain Tissue, Rat Kidney Tissue, Mouse Kidney Tissue, HELA Whole Cell
IHC: mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of CSNK1A1 using anti-CSNK1A1 antibody (PB9693).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: Rat Brain Tissue Lysate,
Lane 2: Rat Kidney Tissue Lysate,
Lane 3: Mouse Kidney Tissue Lysate,
Lane 4: HELA Whole Cell Lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CSNK1A1 antigen affinity purified polyclonal antibody (Catalog # PB9693) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for CSNK1A1 at approximately 39KD. The expected band size for CSNK1A1 is at 39KD.
Click image to see more details
Figure 2. IHC analysis of CSNK1A1 using anti-CSNK1A1 antibody (PB9693).
CSNK1A1 was detected in paraffin-embedded section of mouse intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CSNK1A1 Antibody (PB9693) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of CSNK1A1 using anti-CSNK1A1 antibody (PB9693).
CSNK1A1 was detected in paraffin-embedded section of rat intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CSNK1A1 Antibody (PB9693) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 4. IHC analysis of CSNK1A1 using anti-CSNK1A1 antibody (PB9693).
CSNK1A1 was detected in paraffin-embedded section of human intestinal cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-CSNK1A1 Antibody (PB9693) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For CSNK1A1 (Source: Uniprot.org, NCBI)
Gene Name
CSNK1A1
Full Name
Casein kinase I isoform alpha
Weight
38915 MW
Superfamily
protein kinase superfamily
Alternative Names
Casein kinase I isoform alpha;CKI-alpha;2.7.11.1;CK1;CSNK1A1; CSNK1A1 CK1, CK1a, CKIa, HEL-S-77p, HLCDGP1, PRO2975 casein kinase 1 alpha 1 casein kinase I isoform alpha|CKI-alpha|clock regulator kinase|down-regulated in lung cancer|epididymis secretory sperm binding protein Li 77p
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on CSNK1A1, check out the CSNK1A1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CSNK1A1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband® (PB9693)
Hello CJ!
No publications found for PB9693
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-Caseine Kinase 1 alpha/CSNK1A1 Antibody Picoband®
Question
Is a blocking peptide available for product anti-Caseine Kinase 1 alpha/CSNK1A1 antibody (PB9693)?
Verified Customer
Verified customer
Asked: 2020-04-24
Answer
We do provide the blocking peptide for product anti-Caseine Kinase 1 alpha/CSNK1A1 antibody (PB9693). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-04-24
Question
Do you have a BSA free version of anti-Caseine Kinase 1 alpha/CSNK1A1 antibody PB9693 available?
Verified Customer
Verified customer
Asked: 2019-12-27
Answer
Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Caseine Kinase 1 alpha/CSNK1A1 antibody PB9693 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2019-12-27
Question
Is this PB9693 anti-Caseine Kinase 1 alpha/CSNK1A1 antibody reactive to the isotypes of CSNK1A1?
A. Jones
Verified customer
Asked: 2019-11-27
Answer
The immunogen of PB9693 anti-Caseine Kinase 1 alpha/CSNK1A1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30-68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-11-27
Question
We are currently using anti-Caseine Kinase 1 alpha/CSNK1A1 antibody PB9693 for rat tissue, and we are well pleased with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on bovine tissues as well?
Verified Customer
Verified customer
Asked: 2019-10-18
Answer
The anti-Caseine Kinase 1 alpha/CSNK1A1 antibody (PB9693) has not been validated for cross reactivity specifically with bovine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-10-18
Question
Does PB9693 anti-Caseine Kinase 1 alpha/CSNK1A1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2019-10-04
Answer
It shows on the product datasheet, PB9693 anti-Caseine Kinase 1 alpha/CSNK1A1 antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-10-04
Question
See below the WB image, lot number and protocol we used for cervix carcinoma using anti-Caseine Kinase 1 alpha/CSNK1A1 antibody PB9693. Please let me know if you require anything else.
P. Collins
Verified customer
Asked: 2018-03-29
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-03-29
Question
I was wanting to use your anti-Caseine Kinase 1 alpha/CSNK1A1 antibody for IHC for mouse cervix carcinoma on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse cervix carcinoma identification?
J. Parker
Verified customer
Asked: 2013-08-14
Answer
You can see on the product datasheet, PB9693 anti-Caseine Kinase 1 alpha/CSNK1A1 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse cervix carcinoma in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2013-08-14
