Retinal S antigen (SAG) (NM_000541) Human Recombinant Protein

S-arrestin protein,

Recombinant protein of human S-antigen; retina and pineal gland (arrestin) (SAG)

Product Info Summary

SKU: PROTP10523
Size: 20 µg
Source: HEK293T

Product Name

Retinal S antigen (SAG) (NM_000541) Human Recombinant Protein

View all S-arrestin recombinant proteins

SKU/Catalog Number

PROTP10523

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human S-antigen; retina and pineal gland (arrestin) (SAG)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Retinal S antigen (SAG) (NM_000541) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP10523)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

44.9 kDa

Amino Acid Sequence

MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLTNNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE

Validation Images & Assay Conditions

Gene/Protein Information For SAG (Source: Uniprot.org, NCBI)

Gene Name

SAG

Full Name

S-arrestin

Weight

44.9 kDa

Superfamily

arrestin family

Alternative Names

arrestin 1; RP47,48 kDa protein; S-antigen; retina and pineal gland (arrestin); S-arrestin; visual arrestin SAG RP47, S-AG S-antigen visual arrestin S-arrestin|48 kDa protein|S-antigen; retina and pineal gland (arrestin)|arrestin 1|retinal S-antigen (48 KDa protein)|rod arrestin|rod photoreceptor arrestin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SAG, check out the SAG Infographic

SAG infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SAG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP10523

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Retinal S antigen (SAG) (NM_000541) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Retinal S antigen (SAG) (NM_000541) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Retinal S antigen (SAG) (NM_000541) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP10523
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.