RAB39 (RAB39A) (NM_017516) Human Recombinant Protein

RAB39 protein,

Recombinant protein of human RAB39, member RAS oncogene family (RAB39)

Product Info Summary

SKU: PROTQ14964
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

RAB39 (RAB39A) (NM_017516) Human Recombinant Protein

View all RAB39 recombinant proteins

SKU/Catalog Number

PROTQ14964

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human RAB39, member RAS oncogene family (RAB39)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

RAB39 (RAB39A) (NM_017516) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ14964)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.8 kDa

Amino Acid Sequence

METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVKPRKECFC

Validation Images & Assay Conditions

Gene/Protein Information For RAB39A (Source: Uniprot.org, NCBI)

Gene Name

RAB39A

Full Name

Ras-related protein Rab-39A

Weight

24.8 kDa

Superfamily

small GTPase superfamily

Alternative Names

rab-39; RAB39, member RAS oncogene family; RAB39A; rab-related GTP-binding protein; ras-related protein Rab-39A RAB39A RAB39 RAB39A, member RAS oncogene family ras-related protein Rab-39A|RAB39, member RAS oncogene family|rab-39|rab-related GTP-binding protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on RAB39A, check out the RAB39A Infographic

RAB39A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for RAB39A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ14964

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used RAB39 (RAB39A) (NM_017516) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For RAB39 (RAB39A) (NM_017516) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for RAB39 (RAB39A) (NM_017516) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ14964
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.