PPM1L (NM_139245) Human Recombinant Protein

PP2C epsilon/PPM1L protein,

Recombinant protein of human protein phosphatase 1 (formerly 2C)-like (PPM1L)

Product Info Summary

SKU: PROTQ5SGD2
Size: 20 µg
Source: HEK293T

Product Name

PPM1L (NM_139245) Human Recombinant Protein

View all PP2C epsilon/PPM1L recombinant proteins

SKU/Catalog Number

PROTQ5SGD2

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human protein phosphatase 1 (formerly 2C)-like (PPM1L)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PPM1L (NM_139245) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ5SGD2)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

40.9 kDa

Amino Acid Sequence

MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQNDRLGGLDVLEAEFSKTWEFKNHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSKTEEQ

Validation Images & Assay Conditions

Gene/Protein Information For PPM1L (Source: Uniprot.org, NCBI)

Gene Name

PPM1L

Full Name

Protein phosphatase 1L

Weight

40.9 kDa

Superfamily

PP2C family

Alternative Names

EC 3.1.3; EC 3.1.3.16; MGC132545; MGC132547; PP2C epsilon; PP2CE; PP2CEProtein phosphatase 2C isoform epsilon; PP2C-epsilon; PPM1L; PPM1-LIKE; protein phosphatase 1 (formerly 2C)-like; protein phosphatase 1L; Protein phosphatase 1-like; Protein phosphatase 2C epsilon isoform; protein phosphatase, Mg2+/Mn2+ dependent, 1L PPM1L PP2C-epsilon, PP2CE, PPM1-LIKE protein phosphatase, Mg2+/Mn2+ dependent 1L protein phosphatase 1L|PP2C epsilon

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PPM1L, check out the PPM1L Infographic

PPM1L infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PPM1L: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ5SGD2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PPM1L (NM_139245) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PPM1L (NM_139245) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PPM1L (NM_139245) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ5SGD2
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.