PIG3 (TP53I3) (NM_004881) Human Recombinant Protein

PIG3 protein,

Product Info Summary

SKU: PROTQ53FA7
Size: 20 µg
Source: HEK293T

Product Name

PIG3 (TP53I3) (NM_004881) Human Recombinant Protein

View all PIG3 recombinant proteins

SKU/Catalog Number

PROTQ53FA7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PIG3 (TP53I3) (NM_004881) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ53FA7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

35.4 kDa

Amino Acid Sequence

MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ

Validation Images & Assay Conditions

Gene/Protein Information For TP53I3 (Source: Uniprot.org, NCBI)

Gene Name

TP53I3

Full Name

Quinone oxidoreductase PIG3

Weight

35.4 kDa

Superfamily

zinc-containing alcohol dehydrogenase family

Alternative Names

p53-induced gene 3 protein; PIG3quinone oxidoreductase homolog; quinone oxidoreductase PIG3; tumor protein p53 inducible protein 3; Tumor protein p53-inducible protein 3 TP53I3 PIG3 tumor protein p53 inducible protein 3 quinone oxidoreductase PIG3|p53-induced gene 3 protein|quinone oxidoreductase homolog

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on TP53I3, check out the TP53I3 Infographic

TP53I3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TP53I3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ53FA7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PIG3 (TP53I3) (NM_004881) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PIG3 (TP53I3) (NM_004881) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PIG3 (TP53I3) (NM_004881) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ53FA7
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.