PI3 (NM_002638) Human Recombinant Protein

Trappin-2/Elafin/Skalp protein,

Product Info Summary

SKU: PROTP19957
Size: 20 µg
Source: HEK293T

Product Name

PI3 (NM_002638) Human Recombinant Protein

View all Trappin-2/Elafin/Skalp recombinant proteins

SKU/Catalog Number

PROTP19957

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human peptidase inhibitor 3, skin-derived (PI3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PI3 (NM_002638) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP19957)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

9.9 kDa

Amino Acid Sequence

MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

Validation Images & Assay Conditions

Gene/Protein Information For PI3 (Source: Uniprot.org, NCBI)

Gene Name

PI3

Full Name

Elafin

Weight

9.9 kDa

Alternative Names

cementoin; Elafin; Elastase-specific inhibitor; ESI; ESIWAP four-disulfide core domain protein 14; Peptidase inhibitor 3; peptidase inhibitor 3, skin-derived; PI3; PI-3; pre-elafin; protease inhibitor 3, skin-derived (SKALP); Protease inhibitor WAP3; SKALP; SKALPELAFIN; Skin-derived antileukoproteinase; Trappin2; Trappin-2; WAP four-disulfide core domain 14; WAP3MGC13613; WFDC14elafin PI3 ESI, SKALP, WAP3, WFDC14, cementoin peptidase inhibitor 3 elafin|PI-3|WAP four-disulfide core domain 14|WAP four-disulfide core domain protein 14|elastase-specific inhibitor|peptidase inhibitor 3, skin-derived|pre-elafin|protease inhibitor 3, skin-derived (SKALP)|protease inhibitor WAP3|skin-derived antileukoproteinase|trappin-2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PI3, check out the PI3 Infographic

PI3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PI3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP19957

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PI3 (NM_002638) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PI3 (NM_002638) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PI3 (NM_002638) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP19957
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.