PEDF (SERPINF1) (NM_002615) Human Recombinant Protein

Serpin F1/PEDF protein,

Product Info Summary

SKU: PROTP36955
Size: 20 µg
Source: HEK293T

Product Name

PEDF (SERPINF1) (NM_002615) Human Recombinant Protein

View all Serpin F1/PEDF recombinant proteins

SKU/Catalog Number

PROTP36955

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 (SERPINF1)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PEDF (SERPINF1) (NM_002615) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP36955)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

46.1 kDa

Amino Acid Sequence

MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSMSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTARQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

Validation Images & Assay Conditions

Gene/Protein Information For SERPINF1 (Source: Uniprot.org, NCBI)

Gene Name

SERPINF1

Full Name

Pigment epithelium-derived factor

Weight

46.1 kDa

Superfamily

serpin family

Alternative Names

Cell proliferation-inducing gene 35 protein; EPC-1; EPC-1PIG35; PEDF; PEDFpigment epithelium-derived factor; pigment epithelium derived factor), member 1; proliferation-inducing protein 35; serine (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin; Serpin F1; serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epitheliumderived factor), member 1 SERPINF1 EPC-1, OI12, OI6, PEDF, PIG35 serpin family F member 1 pigment epithelium-derived factor|alpha-2 antiplasmin|cell proliferation-inducing gene 35 protein|serine (or cysteine) proteinase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1|serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1|testis tissue sperm-binding protein Li 70n

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on SERPINF1, check out the SERPINF1 Infographic

SERPINF1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SERPINF1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP36955

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PEDF (SERPINF1) (NM_002615) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PEDF (SERPINF1) (NM_002615) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PEDF (SERPINF1) (NM_002615) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP36955
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.