PDCD10 (NM_007217) Human Recombinant Protein

PDCD10 protein,

Recombinant protein of human programmed cell death 10 (PDCD10), transcript variant 1

Product Info Summary

SKU: PROTQ9BUL8
Size: 20 µg
Source: HEK293T

Product Name

PDCD10 (NM_007217) Human Recombinant Protein

View all PDCD10 recombinant proteins

SKU/Catalog Number

PROTQ9BUL8

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human programmed cell death 10 (PDCD10), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PDCD10 (NM_007217) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BUL8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.5 kDa

Amino Acid Sequence

MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA

Validation Images & Assay Conditions

Gene/Protein Information For PDCD10 (Source: Uniprot.org, NCBI)

Gene Name

PDCD10

Full Name

Programmed cell death protein 10

Weight

24.5 kDa

Superfamily

PDCD10 family

Alternative Names

apoptosis-related protein 15; cerebral cavernous malformations 3; MGC1212; MGC24477; programmed cell death 10; programmed cell death protein 10; TF-1 cell apoptosis-related protein 15; TFAR15CCM3Cerebral cavernous malformations 3 protein PDCD10 CCM3, TFAR15 programmed cell death 10 programmed cell death protein 10|TF-1 cell apoptosis-related protein 15|apoptosis-related protein 15|cerebral cavernous malformations 3 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PDCD10, check out the PDCD10 Infographic

PDCD10 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PDCD10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BUL8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PDCD10 (NM_007217) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PDCD10 (NM_007217) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PDCD10 (NM_007217) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BUL8
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.