PAX8 (NM_013953) Human Recombinant Protein

PAX8 protein,

Product Info Summary

SKU: PROTQ06710
Size: 20 µg
Source: HEK293T

Product Name

PAX8 (NM_013953) Human Recombinant Protein

View all PAX8 recombinant proteins

SKU/Catalog Number

PROTQ06710

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens paired box 8 (PAX8), transcript variant PAX8D

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PAX8 (NM_013953) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ06710)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

34.7 kDa

Amino Acid Sequence

MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGERWWGPRCPDTHPTSPPADRAAMPPLPSQAWWQEVNTLAMPMATPPTPPTARPGASPTPAC

Validation Images & Assay Conditions

Gene/Protein Information For PAX8 (Source: Uniprot.org, NCBI)

Gene Name

PAX8

Full Name

Paired box protein Pax-8

Weight

34.7 kDa

Alternative Names

paired box 8; paired box gene 8; paired box protein Pax-8; paired domain gene 8 PAX8 paired box 8 paired box protein Pax-8|paired domain gene 8

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PAX8, check out the PAX8 Infographic

PAX8 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PAX8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ06710

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PAX8 (NM_013953) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PAX8 (NM_013953) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PAX8 (NM_013953) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ06710
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.