Pancreatic Lipase Related Protein 2 (PNLIPRP2) (NM_005396) Human Recombinant Protein

Pancreatic Lipase Related Protein 2 protein,

Recombinant protein of human pancreatic lipase-related protein 2 (PNLIPRP2)

Product Info Summary

SKU: PROTP54317
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

Pancreatic Lipase Related Protein 2 (PNLIPRP2) (NM_005396) Human Recombinant Protein

View all Pancreatic Lipase Related Protein 2 recombinant proteins

SKU/Catalog Number

PROTP54317

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human pancreatic lipase-related protein 2 (PNLIPRP2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Pancreatic Lipase Related Protein 2 (PNLIPRP2) (NM_005396) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP54317)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

51.9 kDa

Amino Acid Sequence

MMLPPWTLGLLLLATVRGKEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC

Validation Images & Assay Conditions

Gene/Protein Information For PNLIPRP2 (Source: Uniprot.org, NCBI)

Gene Name

PNLIPRP2

Full Name

Pancreatic lipase-related protein 2

Weight

51.9 kDa

Superfamily

AB hydrolase superfamily

Alternative Names

EC 3.1.1; EC 3.1.1.3; galactolipase; pancreatic lipase-related protein 2; PL-RP2; PLRP2EC 3.1.1.26 PNLIPRP2 PLRP2 pancreatic lipase related protein 2 (gene/pseudogene) pancreatic lipase-related protein 2|PL-RP2|cytotoxic T lymphocyte lipase|galactolipase|triacylglycerol lipase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PNLIPRP2, check out the PNLIPRP2 Infographic

PNLIPRP2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PNLIPRP2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP54317

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Pancreatic Lipase Related Protein 2 (PNLIPRP2) (NM_005396) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Pancreatic Lipase Related Protein 2 (PNLIPRP2) (NM_005396) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Pancreatic Lipase Related Protein 2 (PNLIPRP2) (NM_005396) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP54317
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.