PACRG (NM_001080378) Human Recombinant Protein

Pacrg protein,

Recombinant protein of human PARK2 co-regulated (PACRG), transcript variant 2

Product Info Summary

SKU: PROTQ96M98
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

PACRG (NM_001080378) Human Recombinant Protein

View all Pacrg recombinant proteins

SKU/Catalog Number

PROTQ96M98

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human PARK2 co-regulated (PACRG), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

PACRG (NM_001080378) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ96M98)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

29.1 kDa

Amino Acid Sequence

MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAGAFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPYEFFARQGIHDMLEHGGNKILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGKALVPYYRQILPVLNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For PACRG (Source: Uniprot.org, NCBI)

Gene Name

PACRG

Full Name

Parkin coregulated gene protein homolog

Weight

29.1 kDa

Alternative Names

FLJ32724; Glup; HAK005771; Molecular chaperone/chaperonin-binding protein; PARK2 coregulated gene protein; PARK2 co-regulated; PARK2CRG; parkin coregulated gene protein; parkin co-regulated gene protein; RP3-495O10.2 Pacrg|1700008H23Rik|PARK2 co-regulated|parkin coregulated gene protein homolog|PARK2 coregulated gene protein|hypertension-related protein 1-like protein|parkin co-regulated gene protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on PACRG, check out the PACRG Infographic

PACRG infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for PACRG: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ96M98

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used PACRG (NM_001080378) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For PACRG (NM_001080378) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for PACRG (NM_001080378) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ96M98
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.