NUDT10 (NM_153183) Human Recombinant Protein

Nudt10 protein,

Product Info Summary

SKU: PROTQ8NFP7
Size: 20 µg
Source: HEK293T

Product Name

NUDT10 (NM_153183) Human Recombinant Protein

View all Nudt10 recombinant proteins

SKU/Catalog Number

PROTQ8NFP7

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 10 (NUDT10)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NUDT10 (NM_153183) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8NFP7)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18.3 kDa

Amino Acid Sequence

MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPEHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP

Validation Images & Assay Conditions

Gene/Protein Information For NUDT10 (Source: Uniprot.org, NCBI)

Gene Name

NUDT10

Full Name

Diphosphoinositol polyphosphate phosphohydrolase 3-alpha

Weight

18.3 kDa

Superfamily

Nudix hydrolase family

Alternative Names

APS2DIPP3A; Diadenosine 5'-5'''-P1; diphosphoinositol polyphosphate phosphohydrolase 3-alpha; diphosphoinositol polyphosphate phosphohydrolase type 3 alpha; DIPP3a; DIPP-3-alpha; DIPP3-alpha; EC 3.6.1.-; EC 3.6.1.52; hDIPP3alphahAps2; Nucleoside diphosphate-linked moiety X motif 10; nudix (nucleoside diphosphate linked moiety X)-type motif 10; Nudix motif 10; P6-hexaphosphate hydrolase 3-alpha

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NUDT10, check out the NUDT10 Infographic

NUDT10 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NUDT10: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8NFP7

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NUDT10 (NM_153183) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NUDT10 (NM_153183) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NUDT10 (NM_153183) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8NFP7
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.