NFYC (NM_001142589) Human Recombinant Protein

NFYC protein,

Purified recombinant protein of Homo sapiens nuclear transcription factor Y, gamma (NFYC), transcript variant 4

Product Info Summary

SKU: PROTQ13952
Size: 20 µg
Source: HEK293T

Product Name

NFYC (NM_001142589) Human Recombinant Protein

View all NFYC recombinant proteins

SKU/Catalog Number

PROTQ13952

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens nuclear transcription factor Y, gamma (NFYC), transcript variant 4

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NFYC (NM_001142589) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ13952)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

32.6 kDa

Amino Acid Sequence

MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD

Validation Images & Assay Conditions

Gene/Protein Information For NFYC (Source: Uniprot.org, NCBI)

Gene Name

NFYC

Full Name

Nuclear transcription factor Y subunit gamma

Weight

32.6 kDa

Superfamily

NFYC/HAP5 subunit family

Alternative Names

C subunit; nuclear transcription factor Y, gamma NFYC CBF-C, CBFC, H1TF2A, HAP5, HSM, NF-YC nuclear transcription factor Y subunit gamma nuclear transcription factor Y subunit gamma|CAAT box DNA-binding protein subunit C|CCAAT binding factor subunit C|CCAAT transcription binding factor subunit gamma|histone H1 transcription factor large subunit 2A|nuclear transcription factor Y subunit C|nuclear transcription factor Y, gamma|transactivator HSM-1|transactivator HSM-1/2|transcription factor NF-Y, C subunit

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NFYC, check out the NFYC Infographic

NFYC infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NFYC: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ13952

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NFYC (NM_001142589) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NFYC (NM_001142589) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NFYC (NM_001142589) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ13952
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.