NDRG2 (NM_201538) Human Recombinant Protein

Ndrg2 protein,

Product Info Summary

SKU: PROTQ9UN36
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NDRG2 (NM_201538) Human Recombinant Protein

View all Ndrg2 recombinant proteins

SKU/Catalog Number

PROTQ9UN36

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human NDRG family member 2 (NDRG2), transcript variant 5

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NDRG2 (NM_201538) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UN36)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

39.1 kDa

Amino Acid Sequence

MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYVSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC

Validation Images & Assay Conditions

Gene/Protein Information For NDRG2 (Source: Uniprot.org, NCBI)

Gene Name

NDRG2

Full Name

Protein NDRG2

Weight

39.1 kDa

Superfamily

NDRG family

Alternative Names

DKFZp781G1938; FLJ25522; KIAA1248cytoplasmic protein Ndr1; NDR1-related protein NDR2; NDRG family member 2; protein NDRG2; Protein Syld709613; syld709613 protein; SYLDN-myc downstream regulator 2 Ndrg2|AI182517, AU040374, Nd, Ndr2, SYLD|N-myc downstream regulated gene 2|protein NDRG2|N-myc downstream regulated 2|N-myc downstream-regulated gene 2 protein|protein Ndr2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NDRG2, check out the NDRG2 Infographic

NDRG2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NDRG2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UN36

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NDRG2 (NM_201538) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NDRG2 (NM_201538) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NDRG2 (NM_201538) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UN36
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.