NDRG1 (NM_001135242) Human Recombinant Protein

NDRG1 protein,

Product Info Summary

SKU: PROTQ92597
Size: 20 µg
Source: HEK293T

Product Name

NDRG1 (NM_001135242) Human Recombinant Protein

View all NDRG1 recombinant proteins

SKU/Catalog Number

PROTQ92597

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human N-myc downstream regulated 1 (NDRG1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NDRG1 (NM_001135242) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ92597)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

42.7 kDa

Amino Acid Sequence

MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For NDRG1 (Source: Uniprot.org, NCBI)

Gene Name

NDRG1

Full Name

Protein NDRG1

Weight

42.7 kDa

Superfamily

NDRG family

Alternative Names

CAP43; CMT4D; Differentiation-related gene 1 protein; DRG1; DRG-1; DRG1HMSNL; GC4; HMSNL; NDR1; NDRG1; Nickel-specific induction protein Cap43; NMSL; N-myc downstream regulated 1; N-myc downstream-regulated gene 1 protein; protein NDRG1; protein regulated by oxygen-1; PROXY1; Reducing agents and tunicamycin-responsive protein; RIT42; RTP; RTPGC4; TARG1; TDD5; tunicamycin-responsive protein NDRG1 CAP43, CMT4D, DRG-1, DRG1, GC4, HMSNL, NDR1, NMSL, PROXY1, RIT42, RTP, TARG1, TDD5 N-myc downstream regulated 1 protein NDRG1|N-myc downstream-regulated gene 1 protein|differentiation-related gene 1 protein|nickel-specific induction protein Cap43|protein regulated by oxygen-1|reducing agents and tunicamycin-responsive protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NDRG1, check out the NDRG1 Infographic

NDRG1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NDRG1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ92597

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NDRG1 (NM_001135242) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NDRG1 (NM_001135242) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NDRG1 (NM_001135242) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ92597
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.