Click image to see more details
Product Info Summary
| SKU: | PROTQ9QYY1-2 |
|---|---|
| Size: | 5ug,20ug,100ug,500ug,1mg |
| Origin Species: | Mouse |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Mouse recombinant IL-36RA (Interleukin-36 receptor antagonist) protein, AF
View all IL-36Ra/IL-1F5 recombinant proteins
SKU/Catalog Number
PROTQ9QYY1-2
Size
5ug,20ug,100ug,500ug,1mg
Tag
His Tag (C-term)
Description
Interleukin 36 receptor antagonist (IL-36RA) is a 17.21 kDa cytokine with 155 amino acid residues and a member of the IL-36 family. It is mainly secreted from the stomach, lungs, and kidneys. IL-36RA binds to the interleukin-36 receptor and plays a critical role in the anti-inflammatory effect by mediating MAPK and NF-κB signaling pathways. IL-36RA inhibits proinflammatory effect via suppressing production of IL-6, IL-17, and interferon-gamma and promoting production of IL-4.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Mouse recombinant IL-36RA (Interleukin-36 receptor antagonist) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9QYY1-2)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>98% as determined by SDS-PAGE.
Predicted MW
16.962kDa
Molecular weight
The protein has a calculated MW of 17.81 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Activity
Measure by its ability to inhibit IL-36 gamma-induced IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <2 μg/mL.
Endotoxin
<0.1 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAEKVIKGEEISVVPNRALDASLSPVILGVQGGSQCLSCGTEKGPILKLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTSPEADQPVRLTQIPEDPAWDAPITDFYFQQCD with polyhistidine tag at the C-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant mouse IL-36RA
Protein Target Info & Infographic
Gene/Protein Information For IL36RN (Source: Uniprot.org, NCBI)
Gene Name
IL36RN
Full Name
Interleukin-36 receptor antagonist protein
Weight
16.962kDa
Superfamily
IL-1 family
Alternative Names
FIL1 delta, IL-1F5, IL-1HY1, IL-1L1, IL-1RP3, IL-1ra Homolog 1, IL-1 delta IL36RN FIL1, FIL1(DELTA), FIL1D, IL-36Ra, IL1F5, IL1HY1, IL1L1, IL1RP3, IL36RA, PSORP, PSORS14 interleukin 36 receptor antagonist interleukin-36 receptor antagonist protein|IL-1 related protein 3|IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta)|IL-1ra homolog 1|IL1F5 (Canonical product IL-1F5a)|interleukin 1 family, member 5 (delta)|interleukin-1 HY1|interleukin-1 receptor antagonist homolog 1|interleukin-1-like protein 1
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on IL36RN, check out the IL36RN Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for IL36RN: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Mouse recombinant IL-36RA (Interleukin-36 receptor antagonist) protein, AF (PROTQ9QYY1-2)
Hello CJ!
No publications found for PROTQ9QYY1-2
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Mouse recombinant IL-36RA (Interleukin-36 receptor antagonist) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Mouse recombinant IL-36RA (Interleukin-36 receptor antagonist) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
