IL36RN (NM_173170) Human Recombinant Protein

IL-36Ra/IL-1F5 protein,

Product Info Summary

SKU: PROTQ9UBH0
Size: 20 µg
Source: HEK293T

Product Name

IL36RN (NM_173170) Human Recombinant Protein

View all IL-36Ra/IL-1F5 recombinant proteins

SKU/Catalog Number

PROTQ9UBH0

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

IL36RN (NM_173170) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UBH0)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.8 kDa

Amino Acid Sequence

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

Validation Images & Assay Conditions

Gene/Protein Information For IL36RN (Source: Uniprot.org, NCBI)

Gene Name

IL36RN

Full Name

Interleukin-36 receptor antagonist protein

Weight

16.8 kDa

Superfamily

IL-1 family

Alternative Names

FIL1 delta; FIL1; FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta); FIL1DIL-1 delta; IL1F5 (Canonical product IL-1F5a); IL1F5; IL-1HY1; IL-1L1; IL-1RP3; IL36Ra; IL-36Ra; IL36RN; interleukin 1 family, member 5 (delta); interleukin 1, delta; Interleukin 36 Receptor Antagonist; interleukin-1 family member 5; Interleukin-1 HY1; Interleukin-1 receptor antagonist homolog 1; Interleukin-1-like protein 1; Interleukin-36 Receptor Antagonist IL36RN FIL1, FIL1(DELTA), FIL1D, IL-36Ra, IL1F5, IL1HY1, IL1L1, IL1RP3, IL36RA, PSORP, PSORS14 interleukin 36 receptor antagonist interleukin-36 receptor antagonist protein|IL-1 related protein 3|IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta)|IL-1ra homolog 1|IL1F5 (Canonical product IL-1F5a)|interleukin 1 family, member 5 (delta)|interleukin-1 HY1|interleukin-1 receptor antagonist homolog 1|interleukin-1-like protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IL36RN, check out the IL36RN Infographic

IL36RN infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL36RN: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UBH0

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used IL36RN (NM_173170) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For IL36RN (NM_173170) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for IL36RN (NM_173170) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UBH0
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.