MMP1 (NM_002421) Human Recombinant Protein

MMP-1 protein,

Product Info Summary

SKU: PROTP03956
Size: 20 µg
Source: HEK293T

Product Name

MMP1 (NM_002421) Human Recombinant Protein

View all MMP-1 recombinant proteins

SKU/Catalog Number

PROTP03956

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MMP1 (NM_002421) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP03956)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

51.8 kDa

Amino Acid Sequence

MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

Validation Images & Assay Conditions

Gene/Protein Information For MMP1 (Source: Uniprot.org, NCBI)

Gene Name

MMP1

Full Name

Interstitial collagenase

Weight

51.8 kDa

Superfamily

peptidase M10A family

Alternative Names

CLGmatrix metalloprotease 1; CLGN; EC 3.4.24; EC 3.4.24.7; Fibroblast collagenase; interstitial collagenase; matrix metallopeptidase 1 (interstitial collagenase); matrix metalloproteinase 1 (interstitial collagenase); Matrix metalloproteinase-1; MMP1; MMP-1 MMP1 CLG, CLGN matrix metallopeptidase 1 interstitial collagenase|fibroblast collagenase|matrix metallopeptidase 1 (interstitial collagenase)|matrix metalloprotease 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MMP1, check out the MMP1 Infographic

MMP1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MMP1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP03956

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MMP1 (NM_002421) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MMP1 (NM_002421) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MMP1 (NM_002421) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP03956
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.