MIF (NM_002415) Human Recombinant Protein

MIF protein,

Product Info Summary

SKU: PROTP14174
Size: 20 µg
Source: HEK293T

Product Name

MIF (NM_002415) Human Recombinant Protein

View all MIF recombinant proteins

SKU/Catalog Number

PROTP14174

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human macrophage migration inhibitory factor (glycosylation-inhibiting factor) (MIF)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

MIF (NM_002415) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP14174)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

12.3 kDa

Amino Acid Sequence

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Validation Images & Assay Conditions

Gene/Protein Information For MIF (Source: Uniprot.org, NCBI)

Gene Name

MIF

Full Name

Macrophage migration inhibitory factor

Weight

12.3 kDa

Superfamily

MIF family

Alternative Names

EC 5.3.2.1; EC 5.3.3.12; GIFmacrophage migration inhibitory factor; GLIF; Glycosylation-inhibiting factor; L-dopachrome isomerase; L-dopachrome tautomerase; macrophage migration inhibitory factor (glycosylation-inhibiting factor); MIF; MMIF; Phenylpyruvate tautomerase MIF GIF, GLIF, MMIF macrophage migration inhibitory factor macrophage migration inhibitory factor|L-dopachrome isomerase|L-dopachrome tautomerase|epididymis secretory sperm binding protein|macrophage migration inhibitory factor (glycosylation-inhibiting factor)|phenylpyruvate tautomerase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on MIF, check out the MIF Infographic

MIF infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for MIF: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP14174

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used MIF (NM_002415) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For MIF (NM_002415) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for MIF (NM_002415) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP14174
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.