KCNQ4 (NM_172163) Human Recombinant Protein

Kv7.4 protein,

Recombinant protein of human potassium voltage-gated channel, KQT-like subfamily, member 4 (KCNQ4), transcript variant 2

Product Info Summary

SKU: PROTP56696
Size: 20 µg
Source: HEK293T

Product Name

KCNQ4 (NM_172163) Human Recombinant Protein

View all Kv7.4 recombinant proteins

SKU/Catalog Number

PROTP56696

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human potassium voltage-gated channel, KQT-like subfamily, member 4 (KCNQ4), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

KCNQ4 (NM_172163) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP56696)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

71 kDa

Amino Acid Sequence

MAEAPPRRLGLGPPPGDAPRAELVALTAVQSEQGEAGGGGSPRRLGLLGSPLPPGAPLPGPGSGSGSACGQRSSAAHKRYRRLQNWVYNVLERPRGWAFVYHVFIFLLVFSCLVLSVLSTIQEHQELANECLLILEFVMIVVFGLEYIVRVWSAGCCCRYRGWQGRFRFARKPFCVIDFIVFVASVAVIAAGTQGNIFATSALRSMRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFASFLVYLAEKDANSDFSSYADSLWWGTITLTTIGYGDKTPHTWLGRVLAAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAWRLYSTDMSRAYLTATWYYYDSILPSFSSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQKSWSFNDRTRFRASLRLKPRTSAEDAPSEEVAEEKSYQCELTVDDIMPAVKTVIRSIRILKFLVAKRKFKETLRPYDVKDVIEQYSAGHLDMLGRIKSLQTRVDQIVGRGPGDRKAREKGDKGPSDAEVVDEISMMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRSGTSASLGAVQVPLFDPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD

Validation Images & Assay Conditions

Gene/Protein Information For KCNQ4 (Source: Uniprot.org, NCBI)

Gene Name

KCNQ4

Full Name

Potassium voltage-gated channel subfamily KQT member 4

Weight

71 kDa

Superfamily

potassium channel family

Alternative Names

DFNA2; DFNA2A; KQT-like 4; Kv7.4; potassium channel KQT-like 4; Potassium channel subunit alpha KvLQT4; potassium voltage-gated channel subfamily KQT member 4; potassium voltage-gated channel, KQT-like subfamily, member 4; Voltage-gated potassium channel subunit Kv7.4 KCNQ4 DFNA2, DFNA2A, KV7.4 potassium voltage-gated channel subfamily Q member 4 potassium voltage-gated channel subfamily KQT member 4|potassium channel KQT-like 4|potassium channel subunit alpha KvLQT4|potassium channel, voltage gated KQT-like subfamily Q, member 4|potassium voltage-gated channel, KQT-like subfamily, member 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on KCNQ4, check out the KCNQ4 Infographic

KCNQ4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for KCNQ4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP56696

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used KCNQ4 (NM_172163) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For KCNQ4 (NM_172163) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for KCNQ4 (NM_172163) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP56696
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.