Click image to see more details
Product Info Summary
| SKU: | PROTP40225-6 |
|---|---|
| Size: | 5ug,20ug,100ug |
| Origin Species: | Human |
| Source: | Escherichia coli |
| Application: | Cell Culture |
Customers Who Bought This Also Bought
Product info
Product Name
Human recombinant TPO (Thrombopoietin) protein, AF
View all Thrombopoietin/THPO recombinant proteins
SKU/Catalog Number
PROTP40225-6
Size
5ug,20ug,100ug
Tag
His Tag (N-term)
Description
Thrombopoietin (TPO) is a glycoprotein that produced by the liver, kidney, marrow stroma and several other tissues. The TPO level in the blood is mostly negatively correlated with the abundance of platelets and bone marrow megakaryocytes, although multiple states of inflammation or infection, liver failure, and hematological disturbances are associated with unexpectedly high or low circulating levels of the hormone.
Storage & Handling
Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Cite This Product
Human recombinant TPO (Thrombopoietin) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP40225-6)
Form
Lyophilized
Formulation
The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Purity
>95% as determined by SDS-PAGE.
Predicted MW
37.823kDa
Molecular weight
The protein has a calculated MW of 19.6 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Activity
Testing in process
Endotoxin
<0.01 EU per 1 μg of the protein by the LAL method.
Amino Acid Sequence
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL with polyhistidine tag at the N-terminus.
Reconstitution
Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
SDS- PAGE analysis of recombinant human TPO
Protein Target Info & Infographic
Gene/Protein Information For THPO (Source: Uniprot.org, NCBI)
Gene Name
THPO
Full Name
Thrombopoietin
Weight
37.823kDa
Superfamily
EPO/TPO family
Alternative Names
Megakaryocyte colony-stimulating factor, c-MPL Ligand, MGDF, THPO THPO MGDF, MKCSF, ML, MPLLG, THCYT1, TPO thrombopoietin thrombopoietin|MPL ligand|c-mpl ligand|megakaryocyte colony-stimulating factor|megakaryocyte growth and development factor|megakaryocyte stimulating factor|myeloproliferative leukemia virus oncogene ligand|prepro-thrombopoietin
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on THPO, check out the THPO Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for THPO: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Human recombinant TPO (Thrombopoietin) protein, AF (PROTP40225-6)
Hello CJ!
No publications found for PROTP40225-6
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Human recombinant TPO (Thrombopoietin) protein, AF?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Human recombinant TPO (Thrombopoietin) protein, AF
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
