Human recombinant IL-36RA (Interleukin-36 receptor antagonist) protein, AF

IL-36Ra/IL-1F5 protein, Human

Interleukin 36 receptor antagonist (IL-36RA) is a 16.97 kDa member of IL-1 family with 155 amino acid residues. IL-1RA is expressed by lymphoid tissue, skin and secreted to blood. IL-36Ra functions as a receptor antagonist that inhibits the activation of IL-36R signaling and suppresses pro-inflammatory signaling.

Product Info Summary

SKU: PROTQ9UBH0-3
Size: 5ug,20ug,100ug,500ug,1mg
Origin Species: Human
Source: Escherichia coli
Application: Cell Culture

Product Name

Human recombinant IL-36RA (Interleukin-36 receptor antagonist) protein, AF

View all IL-36Ra/IL-1F5 recombinant proteins

SKU/Catalog Number

PROTQ9UBH0-3

Size

5ug,20ug,100ug,500ug,1mg

Tag

His Tag (C-term)

Description

Interleukin 36 receptor antagonist (IL-36RA) is a 16.97 kDa member of IL-1 family with 155 amino acid residues. IL-1RA is expressed by lymphoid tissue, skin and secreted to blood. IL-36Ra functions as a receptor antagonist that inhibits the activation of IL-36R signaling and suppresses pro-inflammatory signaling.

Storage & Handling

Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.

Cite This Product

Human recombinant IL-36RA (Interleukin-36 receptor antagonist) protein, AF (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UBH0-3)

Form

Lyophilized

Formulation

The protein was lyophilized from a 0.2 μm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.

Purity

>98% as determined by SDS-PAGE.

Predicted MW

16.962kDa

Molecular weight

The protein has a calculated MW of 17.77 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).

Activity

Measure by its ability to inhibit IL-36 gamma-induced IL-8 secretion in PBMC cells. The ED₅₀ for this effect is <2 ng/mL in the presence of 500 ng/mL of recombinant human IL-36 gamma.

Endotoxin

<0.1 EU per 1 μg of the protein by the LAL method.

Amino Acid Sequence

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD with polyhistidine tag at the C-terminus.

Reconstitution

Centrifuge at 3000 rpm for 5 mins before opening. It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 100 μg/mL and incubate the stock solution at room temperature for at least 20 mins to ensure sufficient re-dissolved. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein.

Validation Images & Assay Conditions

Gene/Protein Information For IL36RN (Source: Uniprot.org, NCBI)

Gene Name

IL36RN

Full Name

Interleukin-36 receptor antagonist protein

Weight

16.962kDa

Superfamily

IL-1 family

Alternative Names

FIL1 delta, IL-1F5, IL-1HY1, IL-1L1, IL-1RP3, IL-1ra Homolog 1, IL-1 delta IL36RN FIL1, FIL1(DELTA), FIL1D, IL-36Ra, IL1F5, IL1HY1, IL1L1, IL1RP3, IL36RA, PSORP, PSORS14 interleukin 36 receptor antagonist interleukin-36 receptor antagonist protein|IL-1 related protein 3|IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta)|IL-1ra homolog 1|IL1F5 (Canonical product IL-1F5a)|interleukin 1 family, member 5 (delta)|interleukin-1 HY1|interleukin-1 receptor antagonist homolog 1|interleukin-1-like protein 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on IL36RN, check out the IL36RN Infographic

IL36RN infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for IL36RN: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UBH0-3

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Human recombinant IL-36RA (Interleukin-36 receptor antagonist) protein, AF?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Human recombinant IL-36RA (Interleukin-36 receptor antagonist) protein, AF

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Human recombinant IL-36RA (Interleukin-36 receptor antagonist) protein, AF

Size

Total: $77

SKU:PROTQ9UBH0-3

Backordered.

Lead time for this item is typically 2-4 weeks

Get A Quote
In stock
Order Product
PROTQ9UBH0-3
$77.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.