HLA-DRB4 (NM_021983) Human Recombinant Protein

HLA DRB4 protein,

Recombinant protein of human major histocompatibility complex, class II, DR beta 4 (HLA-DRB4)

Product Info Summary

SKU: PROTP13762
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

HLA-DRB4 (NM_021983) Human Recombinant Protein

View all HLA DRB4 recombinant proteins

SKU/Catalog Number

PROTP13762

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human major histocompatibility complex, class II, DR beta 4 (HLA-DRB4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HLA-DRB4 (NM_021983) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP13762)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

27 kDa

Amino Acid Sequence

MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS

Validation Images & Assay Conditions

Gene/Protein Information For HLA-DRB4 (Source: Uniprot.org, NCBI)

Gene Name

HLA-DRB4

Full Name

HLA class II histocompatibility antigen, DR beta 4 chain

Weight

27 kDa

Superfamily

MHC class II family

Alternative Names

class II histocompatibility antigen HLA DR alpha, beta1-0307; DR12; DR-12; DR13; DR-13; DR14; DR-14; DR4; DR-4; DRB1 transplantation antigen; DRB4; HLA class II histocompatibility antigen, DR beta 4 chain; HLA class II histocompatibility antigen, DRB1-12 beta chain; HLA class II histocompatibility antigen, DRB1-4 beta chain; HLA-DR4B; human leucocyte antigen DRB4; leucocyte antigen DRB1; leukocyte antigen; major histocompatibility complex, class II, DR beta 1; major histocompatibility complex, class II, DR beta 4; MHC class I antigen DRB1*12; MHC class I antigen DRB1*4; MHC class II antigen DR HLA-DRB4 DR4, DRB4, HLA-DR4B*, HLA-DRB4 major histocompatibility complex, class II, DR beta 4 major histocompatibility complex, class II, DR beta 4|HLA class II histocompatibility , DR beta 4 chain|MHC class II DRB4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HLA-DRB4, check out the HLA-DRB4 Infographic

HLA-DRB4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HLA-DRB4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: None

Have you used HLA-DRB4 (NM_021983) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HLA-DRB4 (NM_021983) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HLA-DRB4 (NM_021983) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP13762
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.