HES5 (NM_001010926) Human Recombinant Protein

Hes5 protein,

Recombinant protein of human hairy and enhancer of split 5 (Drosophila) (HES5)

Product Info Summary

SKU: PROTQ5TA89
Size: 20 µg
Source: HEK293T

Product Name

HES5 (NM_001010926) Human Recombinant Protein

View all Hes5 recombinant proteins

SKU/Catalog Number

PROTQ5TA89

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human hairy and enhancer of split 5 (Drosophila) (HES5)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

HES5 (NM_001010926) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ5TA89)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

18 kDa

Amino Acid Sequence

MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW

Validation Images & Assay Conditions

Gene/Protein Information For HES5 (Source: Uniprot.org, NCBI)

Gene Name

HES5

Full Name

Transcription factor HES-5

Weight

18 kDa

Alternative Names

BHLHB38; bHLHb38Class B basic helix-loop-helix protein 38; hairy and enhancer of split 5 (Drosophila); Hairy and enhancer of split 5; transcription factor HES-5 Hes5|bHLHb3, bHLHb38|hes family bHLH transcription factor 5|transcription factor HES-5|hairy and enhancer of split 5

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on HES5, check out the HES5 Infographic

HES5 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HES5: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ5TA89

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used HES5 (NM_001010926) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For HES5 (NM_001010926) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for HES5 (NM_001010926) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ5TA89
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.