GnRH (GNRH1) (NM_001083111) Human Recombinant Protein

GnRH protein,

Product Info Summary

SKU: PROTP01148
Size: 20 µg
Source: HEK293T

Product Name

GnRH (GNRH1) (NM_001083111) Human Recombinant Protein

View all GnRH recombinant proteins

SKU/Catalog Number

PROTP01148

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GnRH (GNRH1) (NM_001083111) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP01148)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

7.8 kDa

Amino Acid Sequence

MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI

Validation Images & Assay Conditions

Gene/Protein Information For GNRH1 (Source: Uniprot.org, NCBI)

Gene Name

GNRH1

Full Name

Progonadoliberin-1

Weight

7.8 kDa

Superfamily

GnRH family

Alternative Names

GNRH; GnRH-associated peptide 1; gonadotropin-releasing hormone 1 (leutinizing-releasing hormone); gonadotropin-releasing hormone 1 (luteinizing-releasing hormone); GRH; LHRH; LNRH; luliberin I; Progonadoliberin I; progonadoliberin-1; prolactin release-inhibiting factor GNRH1 GNRH, GRH, LHRH, LNRH gonadotropin releasing hormone 1 progonadoliberin-1|GnRH-associated peptide 1|gonadotropin-releasing hormone 1 (luteinizing-releasing hormone)|leuteinizing-releasing hormone|luliberin I|prolactin release-inhibiting factor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GNRH1, check out the GNRH1 Infographic

GNRH1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GNRH1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP01148

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GnRH (GNRH1) (NM_001083111) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GnRH (GNRH1) (NM_001083111) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GnRH (GNRH1) (NM_001083111) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP01148
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.