GALE (NM_000403) Human Recombinant Protein

GALE protein,

Product Info Summary

SKU: PROTQ14376
Size: 20 µg
Source: HEK293T

Product Name

GALE (NM_000403) Human Recombinant Protein

View all GALE recombinant proteins

SKU/Catalog Number

PROTQ14376

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human UDP-galactose-4-epimerase (GALE), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

GALE (NM_000403) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ14376)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

38.1 kDa

Amino Acid Sequence

MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA

Validation Images & Assay Conditions

Gene/Protein Information For GALE (Source: Uniprot.org, NCBI)

Gene Name

GALE

Full Name

UDP-glucose 4-epimerase

Weight

38.1 kDa

Superfamily

NAD(P)-dependent epimerase/dehydratase family

Alternative Names

EC 5.1.3; EC 5.1.3.2; FLJ95174; FLJ97302; Galactowaldenase; short chain dehydrogenase/reductase family 1E, member 1; UDP galactose-4'-epimerase; UDP-; UDP-galactose 4-epimerase; UDP-galactose-4-epimerase; UDP-glucose 4-epimerase GALE SDR1E1 UDP-galactose-4-epimerase UDP-glucose 4-epimerase|UDP galactose-4-epimerase|UDP-GalNAc 4-epimerase|UDP-GlcNAc 4-epimerase|UDP-N-acetylgalactosamine 4-epimerase|UDP-N-acetylglucosamine 4-epimerase|epididymis secretory sperm binding protein|galactose-4-epimerase, UDP-|galactowaldenase|short chain dehydrogenase/reductase family 1E, member 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on GALE, check out the GALE Infographic

GALE infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for GALE: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ14376

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used GALE (NM_000403) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For GALE (NM_000403) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for GALE (NM_000403) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ14376
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.