G CSF (CSF3) (NM_172220) Human Recombinant Protein

G-CSF protein,

Product Info Summary

SKU: PROTP09919
Size: 20 µg
Source: HEK293T

Product Name

G CSF (CSF3) (NM_172220) Human Recombinant Protein

View all G-CSF recombinant proteins

SKU/Catalog Number

PROTP09919

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

G CSF (CSF3) (NM_172220) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP09919)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

21.4 kDa

Amino Acid Sequence

MSPEPALSPALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP

Validation Images & Assay Conditions

Gene/Protein Information For CSF3 (Source: Uniprot.org, NCBI)

Gene Name

CSF3

Full Name

Granulocyte colony-stimulating factor

Weight

21.4 kDa

Superfamily

IL-6 superfamily

Alternative Names

C17orf33; chromosome 17 open reading frame 33; colony stimulating factor 3 (granulocyte); CSF3; CSF3OS; Filgrastim; GCSF; G-CSF; GCSFlenograstim; granulocyte colony-stimulating factor; Lenograstim; MGC45931; Pluripoietin CSF3 C17orf33OS, GCSF, CSF3 colony stimulating factor 3 granulocyte colony-stimulating factor|filgrastim|granulocyte-colony stimulating factor|lenograstim|pluripoietin

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CSF3, check out the CSF3 Infographic

CSF3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CSF3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP09919

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used G CSF (CSF3) (NM_172220) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For G CSF (CSF3) (NM_172220) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for G CSF (CSF3) (NM_172220) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP09919
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.