FKBP7 (NM_181342) Human Recombinant Protein

Fkbp7 protein,

Recombinant protein of human FK506 binding protein 7 (FKBP7), transcript variant 1

Product Info Summary

SKU: PROTQ9Y680
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FKBP7 (NM_181342) Human Recombinant Protein

View all Fkbp7 recombinant proteins

SKU/Catalog Number

PROTQ9Y680

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human FK506 binding protein 7 (FKBP7), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FKBP7 (NM_181342) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9Y680)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.8 kDa

Amino Acid Sequence

MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL

Validation Images & Assay Conditions

Gene/Protein Information For FKBP7 (Source: Uniprot.org, NCBI)

Gene Name

FKBP7

Full Name

Peptidyl-prolyl cis-trans isomerase FKBP7

Weight

22.8 kDa

Alternative Names

EC 5.2.1.8; FK506 binding protein 7; FK506-binding protein 7FK506-binding protein 23,23 kDa FK506-binding protein; FKBP-23; FKBP23PPIase; FKBP-7; MGC9420; peptidyl-prolyl cis-trans isomerase FKBP7,23 kDa FKBP; PPIase FKBP7; rotamase Fkbp7|23kDa, FKBP-7, FKBP2, FKBP23|FK506 binding protein 7|peptidyl-prolyl cis-trans isomerase FKBP7|23 kDa FK506-binding protein|23 kDa FKBP|FKBP-23|PPIase FKBP7|rotamase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FKBP7, check out the FKBP7 Infographic

FKBP7 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FKBP7: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9Y680

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FKBP7 (NM_181342) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FKBP7 (NM_181342) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FKBP7 (NM_181342) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9Y680
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.