FCGRT (NM_001136019) Human Recombinant Protein

FCRN/FCGRT protein,

Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2

Product Info Summary

SKU: PROTP55899
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FCGRT (NM_001136019) Human Recombinant Protein

View all FCRN/FCGRT recombinant proteins

SKU/Catalog Number

PROTP55899

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FCGRT (NM_001136019) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP55899)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

39.6 kDa

Amino Acid Sequence

MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA

Validation Images & Assay Conditions

Gene/Protein Information For FCGRT (Source: Uniprot.org, NCBI)

Gene Name

FCGRT

Full Name

IgG receptor FcRn large subunit p51

Weight

39.6 kDa

Superfamily

immunoglobulin superfamily

Alternative Names

alpha-chain; Fc fragment of IgG, receptor, transporter, alpha; FCGRT; FcRn alpha chain; FCRN; FCRNimmunoglobulin receptor, intestinal, heavy chain; IgG Fc fragment receptor transporter alpha chain; IgG receptor FcRn large subunit p51; major histocompatibility complex class I-like Fc receptor; Neonatal Fc receptor; neonatal Fc-receptor for Ig FCGRT FCRN, alpha-chain Fc fragment of IgG receptor and transporter IgG receptor FcRn large subunit p51|Fc fragment of IgG, receptor, transporter, alpha|FcRn alpha chain|IgG Fc fragment receptor transporter alpha chain|heavy chain of the major histocompatibility complex class I-like Fc receptor|immunoglobulin receptor, intestinal, heavy chain|major histocompatibility complex class I-like Fc receptor|neonatal Fc receptor|neonatal Fc-receptor for Ig|transmembrane alpha chain of the neonatal receptor

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FCGRT, check out the FCGRT Infographic

FCGRT infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FCGRT: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP55899

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FCGRT (NM_001136019) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FCGRT (NM_001136019) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FCGRT (NM_001136019) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP55899
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.