FAM107A (NM_001076778) Human Recombinant Protein

FAM107A protein,

Recombinant protein of human family with sequence similarity 107, member A (FAM107A), transcript variant 2

Product Info Summary

SKU: PROTO95990
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

FAM107A (NM_001076778) Human Recombinant Protein

View all FAM107A recombinant proteins

SKU/Catalog Number

PROTO95990

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human family with sequence similarity 107, member A (FAM107A), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

FAM107A (NM_001076778) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95990)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

17.3 kDa

Amino Acid Sequence

MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL

Validation Images & Assay Conditions

Gene/Protein Information For FAM107A (Source: Uniprot.org, NCBI)

Gene Name

FAM107A

Full Name

Actin-associated protein FAM107A

Weight

17.3 kDa

Superfamily

FAM107 family

Alternative Names

downregulated in renal cell carcinoma; DRR1family with sequence similarity 107 member A transcript; family with sequence similarity 107, member A; FLJ30158; FLJ45473; Protein TU3A; TU3ADown-regulated in renal cell carcinoma 1 FAM107A DRR1, TU3A family with sequence similarity 107 member A actin-associated protein FAM107A|down-regulated in renal cell carcinoma 1|protein FAM107A

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on FAM107A, check out the FAM107A Infographic

FAM107A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for FAM107A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95990

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used FAM107A (NM_001076778) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For FAM107A (NM_001076778) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for FAM107A (NM_001076778) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95990
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.