EIF3K (NM_013234) Human Recombinant Protein

EIF3K protein,

Product Info Summary

SKU: PROTQ9UBQ5
Size: 20 µg
Source: HEK293T

Product Name

EIF3K (NM_013234) Human Recombinant Protein

View all EIF3K recombinant proteins

SKU/Catalog Number

PROTQ9UBQ5

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human eukaryotic translation initiation factor 3, subunit K (EIF3K)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

EIF3K (NM_013234) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9UBQ5)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

24.9 kDa

Amino Acid Sequence

MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ

Validation Images & Assay Conditions

Gene/Protein Information For EIF3K (Source: Uniprot.org, NCBI)

Gene Name

EIF3K

Full Name

Eukaryotic translation initiation factor 3 subunit K

Weight

24.9 kDa

Superfamily

eIF-3 subunit K family

Alternative Names

ARG134; eIF3k; EIF3-p28; EIF3S12eIF-3 p28; Eukaryotic translation initiation factor 3 subunit 12; eukaryotic translation initiation factor 3 subunit K; eukaryotic translation initiation factor 3, subunit 12; eukaryotic translation initiation factor 3, subunit K; HSPC029; M9; MSTP001; muscle specific; Muscle-specific gene M9 protein; PLAC24; PLAC-24; PLAC-24eIF-3 p25; PRO1474; PTD001 EIF3K ARG134, EIF3-p28, EIF3S12, HSPC029, M9, MSTP001, PLAC-24, PLAC24, PRO1474, PTD001 eukaryotic translation initiation factor 3 subunit K eukaryotic translation initiation factor 3 subunit K|eIF-3 p28|eukaryotic translation initiation factor 3, subunit 12|muscle specific|muscle-specific gene M9 protein

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on EIF3K, check out the EIF3K Infographic

EIF3K infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EIF3K: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9UBQ5

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used EIF3K (NM_013234) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For EIF3K (NM_013234) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for EIF3K (NM_013234) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9UBQ5
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.