DNA Polymerase epsilon (POLE3) (NM_017443) Human Recombinant Protein

DNA Polymerase epsilon subunit 3 protein,

Product Info Summary

SKU: PROTQ9NRF9
Size: 20 µg
Source: HEK293T

Product Name

DNA Polymerase epsilon (POLE3) (NM_017443) Human Recombinant Protein

View all DNA Polymerase epsilon subunit 3 recombinant proteins

SKU/Catalog Number

PROTQ9NRF9

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

DNA Polymerase epsilon (POLE3) (NM_017443) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9NRF9)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

16.7 kDa

Amino Acid Sequence

MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN

Validation Images & Assay Conditions

Gene/Protein Information For POLE3 (Source: Uniprot.org, NCBI)

Gene Name

POLE3

Full Name

DNA polymerase epsilon subunit 3

Weight

16.7 kDa

Alternative Names

Arsenic-transactivated protein; asTP; CHARAC17arsenic transactivated protein; CHRAC-17; CHRAC17Ybl1; Chromatin accessibility complex 17 kDa protein; DNA polymerase epsilon p17 subunit; DNA polymerase epsilon subunit 3; DNA polymerase epsilon subunit p17; DNA polymerase II subunit 3; EC 2.7.7.7; histone fold protein CHRAC17; huCHRAC17; p17; polymerase (DNA directed), epsilon 3 (p17 subunit); YBL1 POLE3 CHARAC17, CHRAC17, CHRAC2, YBL1, p17 DNA polymerase epsilon 3, accessory subunit DNA polymerase epsilon subunit 3|CHRAC-17|DNA polymerase II subunit 3|DNA polymerase epsilon p17 subunit|DNA polymerase epsilon subunit p17|arsenic transactivated protein|asTP|chromatin accessibility complex 17 kDa protein|chromatin accessibility complex subunit 2|histone fold protein CHRAC17|huCHRAC17|polymerase (DNA directed), epsilon 3 (p17 subunit)|polymerase (DNA directed), epsilon 3, accessory subunit|polymerase (DNA) epsilon 3, accessory subunit

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on POLE3, check out the POLE3 Infographic

POLE3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for POLE3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9NRF9

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used DNA Polymerase epsilon (POLE3) (NM_017443) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For DNA Polymerase epsilon (POLE3) (NM_017443) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for DNA Polymerase epsilon (POLE3) (NM_017443) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9NRF9
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.