CYP11A1 (NM_001099773) Human Recombinant Protein

CYP11A1 protein,

Purified recombinant protein of Homo sapiens cytochrome P450, family 11, subfamily A, polypeptide 1 (CYP11A1), transcript variant 2

Product Info Summary

SKU: PROTP05108
Size: 20 µg
Source: HEK293T

Product Name

CYP11A1 (NM_001099773) Human Recombinant Protein

View all CYP11A1 recombinant proteins

SKU/Catalog Number

PROTP05108

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens cytochrome P450, family 11, subfamily A, polypeptide 1 (CYP11A1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CYP11A1 (NM_001099773) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP05108)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

42 kDa

Amino Acid Sequence

MAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISDDLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNLPPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQDMLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVNDLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTFWPFNQEATQQ

Validation Images & Assay Conditions

Gene/Protein Information For CYP11A1 (Source: Uniprot.org, NCBI)

Gene Name

CYP11A1

Full Name

Cholesterol side-chain cleavage enzyme, mitochondrial

Weight

42 kDa

Superfamily

cytochrome P450 family

Alternative Names

Cholesterol desmolase; cholesterol monooxygenase (side-chain-cleaving); cholesterol side-chain cleavage enzyme, mitochondrial; CYPXIA1; Cytochrome P450 11A1; Cytochrome P450(scc); cytochrome P450, family 11, subfamily A, polypeptide 1; cytochrome P450C11A1; EC 1.14.15; EC 1.14.15.6; steroid 20-22-lyase; subfamily XIA (cholesterol side chain cleavage) CYP11A1 CYP11A, CYPXIA1, P450SCC cytochrome P450 family 11 subfamily A member 1 cholesterol side-chain cleavage enzyme, mitochondrial|cholesterol 20-22 desmolase|cholesterol monooxygenase (side-chain cleaving)|cytochrome P450 11A1|cytochrome P450 family 11 subfamily A polypeptide 1|cytochrome P450(scc)|cytochrome P450, subfamily XIA (cholesterol side chain cleavage)|steroid 20-22-lyase

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CYP11A1, check out the CYP11A1 Infographic

CYP11A1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CYP11A1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP05108

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CYP11A1 (NM_001099773) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CYP11A1 (NM_001099773) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CYP11A1 (NM_001099773) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP05108
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.