Collagen IX (COL9A1) (NM_078485) Human Recombinant Protein

COL9A1 protein,

Recombinant protein of human collagen, type IX, alpha 1 (COL9A1), transcript variant 2

Product Info Summary

SKU: PROTP20849
Size: 20 µg
Source: HEK293T

Product Name

Collagen IX (COL9A1) (NM_078485) Human Recombinant Protein

View all COL9A1 recombinant proteins

SKU/Catalog Number

PROTP20849

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human collagen, type IX, alpha 1 (COL9A1), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

Collagen IX (COL9A1) (NM_078485) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP20849)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

62 kDa

Amino Acid Sequence

MAWTARDRGALGLLLLGLCLCAAQRGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGPPGPPGPAGEPGKPGAPGKPGTPGADGLTGPDGSPGSIGSKGQKGEPGVPGSRGFPGRGIPGPPGPPGTAGLPGELGRVGPVGDPGRRGPPGPPGPPGPRGTIGFHDGDPLCPNACPPGRSGYPGLPGMRGHKGAKGEIGEPGRQGHKGEEGDQGELGEVGAQGPPGAQGLRGITGIVGDKGEKGARGLDGEPGPQGLPGAPGDQGQRGPPGEAGPKGDRGAEGARGIPGLPGPKGDTGLPGVDGRDGIPGMPGTKGEPGKPGPPGDAGLQGLPGVPGIPGAKGVAGEKGSTGAPGKPGQMGNSGKPGQQGPPGEVGPRGPQGLPGSRGELGPVGSPGLPGKLGSLGSPGLPGLPGPPGLPGMKGDRGVVGEPGPKGEQGASGEEGEAGERGELGDIGLPGPKGSAGNPGEPGLRGPEGSRGLPGVEGPRGPPGPRGVQGEQGATGLPGVQGPPGRAPTDQHIKQVCMRVIQEHFAEMAASLKRPDSGATGLPGRPGPPGPPGPPGENGFPGQMGIRGLPGIKGPPGALGLRGPKGDLGEKGERGPPGRGPNGLPGAIGLPGDPGPASYGRNGRDGERGPPGVAGIPGVPGPPGPPGLPGFCEPASCTMQAGQRAFNKGPDP

Validation Images & Assay Conditions

Gene/Protein Information For COL9A1 (Source: Uniprot.org, NCBI)

Gene Name

COL9A1

Full Name

Collagen alpha-1(IX) chain

Weight

62 kDa

Superfamily

fibril-associated collagens with interrupted helices (FACIT) family

Alternative Names

alpha-1 polypeptide; collagen, type IX, alpha 1 COL9A1 DJ149L1.1.2, EDM6, MED, STL4 collagen type IX alpha 1 chain collagen alpha-1(IX) chain|alpha-1(IX) collagen chain|cartilage-specific short collagen|collagen IX, alpha-1 polypeptide|collagen, type IX, alpha 1

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on COL9A1, check out the COL9A1 Infographic

COL9A1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for COL9A1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP20849

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Collagen IX (COL9A1) (NM_078485) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Collagen IX (COL9A1) (NM_078485) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Collagen IX (COL9A1) (NM_078485) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP20849
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.