CLIC2 (NM_001289) Human Recombinant Protein

CLIC2 protein,

Product Info Summary

SKU: PROTO15247
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CLIC2 (NM_001289) Human Recombinant Protein

View all CLIC2 recombinant proteins

SKU/Catalog Number

PROTO15247

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chloride intracellular channel 2 (CLIC2)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CLIC2 (NM_001289) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO15247)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

28.2 kDa

Amino Acid Sequence

MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS

Validation Images & Assay Conditions

Gene/Protein Information For CLIC2 (Source: Uniprot.org, NCBI)

Gene Name

CLIC2

Full Name

Chloride intracellular channel protein 2

Weight

28.2 kDa

Superfamily

chloride channel CLIC family

Alternative Names

chloride intracellular channel 2; chloride intracellular channel protein 2; XAP121CLIC2b CLIC2 CLCNL2b, MRXS32, XAP121, CLIC2 chloride intracellular channel 2 chloride intracellular channel protein 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CLIC2, check out the CLIC2 Infographic

CLIC2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CLIC2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO15247

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CLIC2 (NM_001289) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CLIC2 (NM_001289) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CLIC2 (NM_001289) Human Recombinant Protein

$1062
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO15247
$1,062.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product