CEACAM3 (NM_001815) Human Recombinant Protein

CEACAM3/CD66d protein,

Product Info Summary

SKU: PROTP40198
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

CEACAM3 (NM_001815) Human Recombinant Protein

View all CEACAM3/CD66d recombinant proteins

SKU/Catalog Number

PROTP40198

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 3 (CEACAM3)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CEACAM3 (NM_001815) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP40198)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.4 kDa

Amino Acid Sequence

MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSMSPLSTAQAPLPNPRTAASIYEELLKHDTNIYCRMDHKAEVAS

Validation Images & Assay Conditions

Gene/Protein Information For CEACAM3 (Source: Uniprot.org, NCBI)

Gene Name

CEACAM3

Full Name

Carcinoembryonic antigen-related cell adhesion molecule 3

Weight

23.4 kDa

Superfamily

immunoglobulin superfamily

Alternative Names

CD66d; CEA; CEACAM3 carcinoembryonic antigen-related cell adhesion molecule 3; CEACAM-3; CGM1; W264; W282 CEACAM3 CD66D, CEA, CGM1, W264, W282 CEA cell adhesion molecule 3 carcinoembryonic antigen-related cell adhesion molecule 3|CD66d antigen|carcinoembryonic antigen CGM1|carcinoembryonic antigen gene family member 1|carcinoembryonic antigen related cell adhesion molecule 3|nonspecific cross-reacting antigen

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CEACAM3, check out the CEACAM3 Infographic

CEACAM3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CEACAM3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTP40198

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CEACAM3 (NM_001815) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CEACAM3 (NM_001815) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CEACAM3 (NM_001815) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTP40198
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.