CD83 (NM_004233) Human Recombinant Protein

CD83 protein,

Product Info Summary

SKU: PROTQ01151
Size: 20 µg
Source: HEK293T

Product Name

CD83 (NM_004233) Human Recombinant Protein

View all CD83 recombinant proteins

SKU/Catalog Number

PROTQ01151

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human CD83 molecule (CD83), transcript variant 1

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CD83 (NM_004233) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ01151)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

22.9 kDa

Amino Acid Sequence

MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV

Validation Images & Assay Conditions

Gene/Protein Information For CD83 (Source: Uniprot.org, NCBI)

Gene Name

CD83

Full Name

CD83 antigen

Weight

22.9 kDa

Alternative Names

B-cell activation protein; BL11; BL11CD83 antigen; CD83 antigen (activated B lymphocytes, immunoglobulin superfamily); CD83 molecule; CD83; Cell surface protein HB15; cell-surface glycoprotein; HB15; HB15hCD83 CD83 BL11, HB15 CD83 molecule CD83 antigen|B-cell activation protein|CD83 antigen (activated B lymphocytes, immunoglobulin superfamily)|cell surface protein HB15|cell-surface glycoprotein|hCD83

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CD83, check out the CD83 Infographic

CD83 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CD83: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ01151

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CD83 (NM_004233) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CD83 (NM_004233) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CD83 (NM_004233) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ01151
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.