CD244 (NM_001166664) Human Recombinant Protein

2B4/CD244/SLAMF4 protein,

Product Info Summary

SKU: PROTQ9BZW8
Size: 20 µg
Source: HEK293T

Product Name

CD244 (NM_001166664) Human Recombinant Protein

View all 2B4/CD244/SLAMF4 recombinant proteins

SKU/Catalog Number

PROTQ9BZW8

Size

20 µg

Tag

C-Myc/DDK

Description

Purified recombinant protein of Homo sapiens CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 3.

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

CD244 (NM_001166664) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ9BZW8)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

0.0312kDa

Amino Acid Sequence

MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFEFRFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQEQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSRKELENFDVYS

Validation Images & Assay Conditions

There are currently no images for this product. We are working on uploading them please check back shortly or contact us to expedite our upload process for this antibody.

Gene/Protein Information For CD244 (Source: Uniprot.org, NCBI)

Gene Name

CD244

Full Name

Natural killer cell receptor 2B4

Weight

0.0312kDa

Alternative Names

2B4; CD244 antigen; CD244 molecule, natural killer cell receptor 2B4; CD244; h2B4; NAIL; NAILNK cell activation-inducing ligand; natural killer cell receptor 2B4; NKR2B4; NKR2B4NK cell type I receptor protein 2B4,2B4CD244 natural killer cell receptor 2B4; Nmrk; SLAMF4; SLAMF4NK cell activation inducing ligand NAIL CD244 2B4, NAIL, NKR2B4, Nmrk, SLAMF4 CD244 molecule natural killer cell receptor 2B4|CD244 molecule, natural killer cell receptor 2B4|NK cell activation inducing ligand NAIL|NK cell activation-inducing ligand|NK cell type I receptor protein 2B4|SLAM family member 4|h2B4|signaling lymphocytic activation molecule 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on CD244, check out the CD244 Infographic

CD244 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for CD244: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ9BZW8

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used CD244 (NM_001166664) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For CD244 (NM_001166664) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for CD244 (NM_001166664) Human Recombinant Protein

$813
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ9BZW8
$813.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.