C3orf10 (BRK1) (NM_018462) Human Recombinant Protein

BRICK1 protein,

Product Info Summary

SKU: PROTQ8WUW1
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

C3orf10 (BRK1) (NM_018462) Human Recombinant Protein

View all BRICK1 recombinant proteins

SKU/Catalog Number

PROTQ8WUW1

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human chromosome 3 open reading frame 10 (C3orf10)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

C3orf10 (BRK1) (NM_018462) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8WUW1)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

8.6 kDa

Amino Acid Sequence

MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT

Validation Images & Assay Conditions

Gene/Protein Information For BRK1 (Source: Uniprot.org, NCBI)

Gene Name

BRK1

Full Name

Protein BRICK1

Weight

8.6 kDa

Superfamily

BRK1 family

Alternative Names

BRK1; Brk1-like; chromosome 3 open reading frame 10; hHBrk1; HSPC300; MDS027; probable protein BRICK1 BRK1 C3orf10, HSPC300, MDS027, hHBrk1 BRICK1 subunit of SCAR/WAVE actin nucleating complex protein BRICK1|BRICK1, SCAR/WAVE actin nucleating complex subunit|haematopoietic stem/progenitor cell protein 300

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on BRK1, check out the BRK1 Infographic

BRK1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for BRK1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8WUW1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used C3orf10 (BRK1) (NM_018462) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For C3orf10 (BRK1) (NM_018462) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for C3orf10 (BRK1) (NM_018462) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8WUW1
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.