Click image to see more details
Product Info Summary
| SKU: | PROTP08581 |
|---|---|
| Size: | 2ug, 10ug, 100ug |
| Origin Species: | Human |
| Source: | Insect cells |
Customers Who Bought This Also Bought
Product info
Product Name
Met Proto-Oncogene Human Recombinant Protein
View all HGFR/c-MET recombinant proteins
SKU/Catalog Number
PROTP08581
Size
2ug, 10ug, 100ug
Description
Met Proto-Oncogene Human Recombinant produced in Insect cells amino acids 1039-1345, having a molecular weight of 34.6kDa. MET is purified by proprietary chromatographic techniques.
Storage & Handling
Store at 4°C if entire vial will be used within 2-4 weeks. Store frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Cite This Product
Met Proto-Oncogene Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTP08581)
Form
Sterile Filtered clear colorless solution.
Formulation
MET protein (1mg/ml) is supplied in 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.
Purity
Greater than 90.0% as determined by SDS-PAGE.
Amino Acid Sequence
DSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTL LDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVL PYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDE KFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFG VLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEM RPSFSELVSRISAIFSTFI
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
Recombinant protein fun image
Protein Target Info & Infographic
Gene/Protein Information For MET (Source: Uniprot.org, NCBI)
Gene Name
MET
Full Name
Hepatocyte growth factor receptor
Weight
Superfamily
protein kinase superfamily
Alternative Names
AUTS9; cMET; c-MET; EC 2.7.10; EC 2.7.10.1; hepatocyte growth factor receptor; HGF R; HGF receptor; HGF/SF receptor; HGFR; Met (c-Met); met proto-oncogene (hepatocyte growth factor receptor); met proto-oncogene tyrosine kinase; MET; oncogene MET; Proto-oncogene c-Met; RCCP2; Scatter factor receptor; SF receptor; Tyrosine-protein kinase Met MET AUTS9, DFNB97, HGFR, RCCP2, c-Met MET proto-oncogene, receptor tyrosine kinase hepatocyte growth factor receptor|HGF receptor|HGF/SF receptor|SF receptor|proto-oncogene c-Met|scatter factor receptor|tyrosine-protein kinase Met
*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".For more info on MET, check out the MET Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for MET: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].
Specific Publications For Met Proto-Oncogene Human Recombinant Protein (PROTP08581)
Hello CJ!
No publications found for PROTP08581
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Met Proto-Oncogene Human Recombinant Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Met Proto-Oncogene Human Recombinant Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
